PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca55281.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family GATA
Protein Properties Length: 286aa    MW: 32299.6 Da    PI: 9.0768
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca55281.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.31.2e-19209243135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 Cs+Cg+ kTp+WR gpdg++tLCnaCG++y++ +l
  Dca55281.1 209 CSHCGVHKTPQWRVGPDGERTLCNACGVRYKSGRL 243
                 *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.123203239IPR000679Zinc finger, GATA-type
SMARTSM004013.9E-16203257IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.14E-14205266No hitNo description
Gene3DG3DSA:3.30.50.108.8E-15207241IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.93E-15208265No hitNo description
PfamPF003201.5E-17209243IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MKNIVKGGLT PKMILDDVSS HLSPLLFHHS RFGGDVGVGV GVGVGDADDF FVDQLLNLNN  60
VVVDETQPLE TVIVHQQQQP QQQQQQQQHE YLTSKLQQQQ RQQQQQVFED KDASFLSSPL  120
DTAEEADLEW LSHFVDDSSC PYSAPFPPGY SRLDCKPEPK PKPKPKPKPA RPPLSLKRDR  180
KRNRVWARPS SNVSLGQGKG KGQGQQKRCS HCGVHKTPQW RVGPDGERTL CNACGVRYKS  240
GRLLPEYRPA CSPSFSSALH SNNHKKVMEM RMMKYNMNKE EEKCFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010679831.11e-52PREDICTED: GATA transcription factor 7
TrEMBLA0A0J8C7241e-52A0A0J8C724_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.13e-37GATA transcription factor 7